PDB entry 3k82

View 3k82 on RCSB PDB site
Description: Crystal Structure of the third PDZ domain of PSD-95
Class: cell adhesion
Keywords: alpha and beta protein, Cell junction, Cell membrane, Lipoprotein, Membrane, Palmitate, Phosphoprotein, Postsynaptic cell membrane, SH3 domain, Synapse, CELL ADHESION
Deposited on 2009-10-13, released 2010-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352 (0-97)
      • engineered (27)
    Domains in SCOPe 2.07: d3k82a_
  • Heterogens: PO4, GOL, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3k82A (A:)
    edipreprrivihrgstglgfnivggexgegifisfilaggpadlsgelrkgdqilsvng
    vdlrnasheqaaialknagqtvtiiaqykpeeysrfea