PDB entry 3k80

View 3k80 on RCSB PDB site
Description: Structure of essential protein from Trypanosoma brucei
Class: Immune System, RNA Binding Protein
Keywords: RNA-editing, OB-fold, RNA-binding proteins, Immune System, RNA Binding Protein
Deposited on 2009-10-13, released 2010-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.226
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3K80 (0-End)
    Domains in SCOPe 2.07: d3k80a1, d3k80a2
  • Chain 'B':
    Compound: antibody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3K80
    Domains in SCOPe 2.07: d3k80b1, d3k80b2
  • Chain 'C':
    Compound: MP18 RNA editing complex protein
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb10.70.2090
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: MP18 RNA editing complex protein
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb10.70.2090
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k80A (A:)
    qvqlqesggglvqagdslrlscvasgrafssygmgwfrqapgkerafvaaisrsggltqy
    aeslkgrfaisrdnakntvylqmgslkpedtavyycagdlyglgshmeneydswgqgtqv
    tvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k80A (A:)
    qvqlqesggglvqagdslrlscvasgrafssygmgwfrqapgkerafvaaisrsggltqy
    aeslkgrfaisrdnakntvylqmgslkpedtavyycagdlyglgshmeneydswgqgtqv
    tvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k80B (B:)
    qvqlqesggglvqagdslrlscvasgrafssygmgwfrqapgkerafvaaisrsggltqy
    aeslkgrfaisrdnakntvylqmgslkpedtavyycagdlyglgshmeneydswgqgtqv
    tvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k80B (B:)
    vqlqesggglvqagdslrlscvasgrafssygmgwfrqapgkerafvaaisrsggltqya
    eslkgrfaisrdnakntvylqmgslkpedtavyycagdlyglgshmeneydswgqgtqvt
    vssh
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.