PDB entry 3k7z
View 3k7z on RCSB PDB site
Description: GCN4-Leucine zipper core mutant as N16A trigonal automatic solution
Class: DNA binding protein
Keywords: COILED COIL, PEPTIDE, LEUCINE ZIPPER, Structural Genomics, TB Structural Genomics Consortium, TBSGC, Activator, Amino-acid biosynthesis, DNA-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation
Deposited on
2009-10-13, released
2009-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-11-24, with a file datestamp of
2009-11-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: -1.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: General control protein GCN4
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3k7za_ - Chain 'B':
Compound: General control protein GCN4
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3k7zb_ - Chain 'C':
Compound: General control protein GCN4
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3k7zc_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3k7zA (A:)
rmkqledkveellskayhlenevarlkklvger
Sequence, based on observed residues (ATOM records): (download)
>3k7zA (A:)
rmkqledkveellskayhlenevarlkklvg
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3k7zB (B:)
rmkqledkveellskayhlenevarlkklvger
Sequence, based on observed residues (ATOM records): (download)
>3k7zB (B:)
rmkqledkveellskayhlenevarlkklvg
- Chain 'C':
Sequence, based on SEQRES records: (download)
>3k7zC (C:)
rmkqledkveellskayhlenevarlkklvger
Sequence, based on observed residues (ATOM records): (download)
>3k7zC (C:)
kqledkveellskayhlenevarlkklvg