PDB entry 3k7y

View 3k7y on RCSB PDB site
Description: Aspartate Aminotransferase of Plasmodium falciparum
Class: transferase
Keywords: Aspartate aminotransferase Plasmodium falciparum, Aminotransferase, Pyridoxal phosphate, Transferase
Deposited on 2009-10-13, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PFB0200c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k7ya_
  • Heterogens: PLP, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3k7yA (A:)
    mdkllsslenievdnilktarefkedtceekinlsigvccnddgdlhifdsvlnadklvt
    enykekpyllgngtedfstltqnlifgnnskyiedkkictiqciggtgaifvlleflkml
    nvetlyvtnppyinhvnmiesrgfnlkyinffdynlidinydlflndlrnipngssvilq
    iscynpcsvnieekyfdeiieivlhkkhviifdiayqgfghtnleedvllirkfeeknia
    fsvcqsfsknmslygeragalhivcknqeekkivfnnlcfivrkfysspvihtnrilcql
    lnnqnlklnwikelsqlsqritnnrilffnkletyqkkynlnydwnvykkqrglfsfvpl
    lakiaehlkthhiyiinngrinvsgitknnvdyiadkiclslsqi