PDB entry 3k7s

View 3k7s on RCSB PDB site
Description: Complex of Trypanosoma cruzi ribose 5-phosphate isomerase type B with ribose 5-phosphate
Class: isomerase
Keywords: pentose phosphate pathway, Type B ribose 5-phosphate isomerase (RpiB), R5P, ISOMERASE
Deposited on 2009-10-13, released 2010-10-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.172
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribose 5-phosphate isomerase
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: 110984573
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3k7sa_
  • Chain 'B':
    Compound: Ribose 5-phosphate isomerase
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: 110984573
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3k7sb_
  • Chain 'C':
    Compound: Ribose 5-phosphate isomerase
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: 110984573
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3k7sc_
  • Chain 'D':
    Compound: Ribose 5-phosphate isomerase
    Species: Trypanosoma cruzi [TaxId:353153]
    Gene: 110984573
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3k7sd_
  • Heterogens: R52, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k7sA (A:)
    mgsshhhhhhssglvprgshmtrrvaigtdhpafaihenlilyvkeagdefvpvycgpkt
    aesvdypdfasrvaemvarkevefgvlacgsgigmsiaankvpgvraalchdhytaamsr
    ihndanivcvgerttgvevireiiitflqtpfsgeerhvrriekiraieashagkkgvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k7sA (A:)
    mtrrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvark
    evefgvlacgsgigmsiaankvpgvraalchdhytaamsrihndanivcvgerttgvevi
    reiiitflqtpfsgeerhvrriekiraieash
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k7sB (B:)
    mgsshhhhhhssglvprgshmtrrvaigtdhpafaihenlilyvkeagdefvpvycgpkt
    aesvdypdfasrvaemvarkevefgvlacgsgigmsiaankvpgvraalchdhytaamsr
    ihndanivcvgerttgvevireiiitflqtpfsgeerhvrriekiraieashagkkgvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k7sB (B:)
    trrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvarke
    vefgvlacgsgigmsiaankvpgvraalchdhytaamsrihndanivcvgerttgvevir
    eiiitflqtpfsgeerhvrriekiraieash
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3k7sC (C:)
    mgsshhhhhhssglvprgshmtrrvaigtdhpafaihenlilyvkeagdefvpvycgpkt
    aesvdypdfasrvaemvarkevefgvlacgsgigmsiaankvpgvraalchdhytaamsr
    ihndanivcvgerttgvevireiiitflqtpfsgeerhvrriekiraieashagkkgvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k7sC (C:)
    mtrrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvark
    evefgvlacgsgigmsiaankvpgvraalchdhytaamsrihndanivcvgerttgvevi
    reiiitflqtpfsgeerhvrriekiraieash
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3k7sD (D:)
    mgsshhhhhhssglvprgshmtrrvaigtdhpafaihenlilyvkeagdefvpvycgpkt
    aesvdypdfasrvaemvarkevefgvlacgsgigmsiaankvpgvraalchdhytaamsr
    ihndanivcvgerttgvevireiiitflqtpfsgeerhvrriekiraieashagkkgvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k7sD (D:)
    trrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvarke
    vefgvlacgsgigmsiaankvpgvraalchdhytaamsrihndanivcvgerttgvevir
    eiiitflqtpfsgeerhvrriekiraieash