PDB entry 3k78

View 3k78 on RCSB PDB site
Description: Crystal structure of bet v1 d
Class: allergen
Keywords: bet v1 d, allergen, pollen allergy, Pathogenesis-related protein, Plant defense
Deposited on 2009-10-12, released 2010-01-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.274
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major pollen allergen Bet v 1-D/H
    Species: Betula pendula [TaxId:3505]
    Gene: BETV1D, BETV1H
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3k78a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k78A (A:)
    mgvfnyeiettsvipaarlfkafildgdnlvpkvapqaissveniegnggpgtikkinfp
    egfpfkyvkdrvdevdhtnfkynysvieggpvgdtlekisneikivatpdggcvlkisnk
    yhtkgnhevkaeqvkaskemgetllravesyllahsdayn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k78A (A:)
    vfnyeiettsvipaarlfkafildgdnlvpkvapqaissveniegnggpgtikkinfpeg
    fpfkyvkdrvdevdhtnfkynysvieggpvgdtlekisneikivatpdggcvlkisnkyh
    tkgnhevkaeqvkaskemgetllravesyllahsda