PDB entry 3k6n

View 3k6n on RCSB PDB site
Description: Crystal structure of the S225E mutant Kir3.1 cytoplasmic pore domain
Class: metal transport
Keywords: BETA BARREL, CYTOPLASMIC DOMAIN, G PROTEIN, INWARD RECTIFIER, POTASSIUM CHANNEL, METAL TRANSPORT, Ion transport, Ionic channel, Transmembrane
Deposited on 2009-10-09, released 2009-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G protein-activated inward rectifier potassium channel 1
    Species: Mus musculus [TaxId:10090]
    Gene: Girk1, Kcnj3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6na_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k6nA (A:)
    gskkrqrfvdkngrcnvqhgnlgseraetlmfsehavismrdgkltlmfrvgnlrnshmv
    eaqirckllksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydls
    qrsmqteqfevvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysq
    fhatfevptppysvkeqeemllmsspl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6nA (A:)
    qrfvdkngrcnvqhtlmfsehavismrdgkltlmfrvgnveaqirckllksrqtpegefl
    pldqleldvgfstgadqlflvspltichvidakspfydlsqrsmqteqfevvvilegigm
    tcqartsytedevlwghrffpvisfkvdysqfhatfevptppysvkeqeemllms