PDB entry 3k6m

View 3k6m on RCSB PDB site
Description: Dynamic domains of Succinyl-CoA:3-ketoacid-coenzyme A transferase from pig heart.
Class: transferase
Keywords: SCOT, CoA Transferase, dynamic domain, glycerol, Mitochondrion, Transferase, Transit peptide
Deposited on 2009-10-09, released 2010-07-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.166
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3k6ma1, d3k6ma2
  • Chain 'B':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3k6mb1, d3k6mb2
  • Chain 'C':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3k6mc1, d3k6mc2
  • Chain 'D':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3k6md1, d3k6md2
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k6mA (A:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeedvktrsgklgdnvreriikraalefedgmyanlgigipllasnfispnmtv
    hlqsengilglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltml
    gamqvskygdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlp
    ltgkqcvnriitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6mA (A:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyp
    lqnevdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwm
    ipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriiteka
    vfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k6mB (B:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeedvktrsgklgdnvreriikraalefedgmyanlgigipllasnfispnmtv
    hlqsengilglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltml
    gamqvskygdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlp
    ltgkqcvnriitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6mB (B:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrnvreriikraalefedgmyanlgigipllasnfimtvhlqsengilglgpyplq
    nevdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmip
    gvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdv
    drkkgltlielwegltvddikkstgcdfavspklipmqqvt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3k6mC (C:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeedvktrsgklgdnvreriikraalefedgmyanlgigipllasnfispnmtv
    hlqsengilglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltml
    gamqvskygdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlp
    ltgkqcvnriitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6mC (C:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpy
    plqnevdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanw
    mipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitek
    avfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3k6mD (D:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeedvktrsgklgdnvreriikraalefedgmyanlgigipllasnfispnmtv
    hlqsengilglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltml
    gamqvskygdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlp
    ltgkqcvnriitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6mD (D:)
    tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikyiaiaskprevrefngqhfileeairgdfalvkawkadqagnvtfr
    ksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekrierlsv
    rkevreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqn
    evdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipg
    klvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfd
    vdrkkgltlielwegltvddikkstgcdfavspklipmqqvt