PDB entry 3k6f

View 3k6f on RCSB PDB site
Description: Crystal structure of mouse T-cadherin EC1
Class: cell adhesion
Keywords: T-cadherin, cell adhesion, Calcium, Cell membrane, Cleavage on pair of basic residues, Glycoprotein, GPI-anchor, Lipoprotein, Membrane
Deposited on 2009-10-08, released 2010-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.168
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: T-cadherin
  Species: Mus musculus [TaxId:10090]
  Gene: Cdh13
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WTR5 (2-99)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d3k6fa1, d3k6fa2
• Chain 'B':
  Compound: T-cadherin
  Species: Mus musculus [TaxId:10090]
  Gene: Cdh13
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WTR5 (2-99)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d3k6fb1, d3k6fb2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3k6fA (A:)
  sgivvspilipenqrqpfprdvgkvvdsdrpegskfrltgkgvdqdpkgtfrinentgsv
  svtrtldretiatyqlyvettdasgktlegpvplevivid
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3k6fB (B:)
  sgivvspilipenqrqpfprdvgkvvdsdrpegskfrltgkgvdqdpkgtfrinentgsv
  svtrtldretiatyqlyvettdasgktlegpvplevivid