PDB entry 3k6c

View 3k6c on RCSB PDB site
Description: Crystal structure of protein ne0167 from nitrosomonas europaea
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, MCSG, unknown function PROTEIN, PSI, PROTEIN STRUCTURE INITIATIVE, MIDWEST CENTER FOR STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2009-10-08, released 2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein NE0167
    Species: Nitrosomonas europaea [TaxId:915]
    Gene: NE0167
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6ca_
  • Chain 'B':
    Compound: Uncharacterized protein NE0167
    Species: Nitrosomonas europaea [TaxId:915]
    Gene: NE0167
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6cb_
  • Chain 'C':
    Compound: Uncharacterized protein NE0167
    Species: Nitrosomonas europaea [TaxId:915]
    Gene: NE0167
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6cc_
  • Chain 'D':
    Compound: Uncharacterized protein NE0167
    Species: Nitrosomonas europaea [TaxId:915]
    Gene: NE0167
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6cd_
  • Chain 'E':
    Compound: Uncharacterized protein NE0167
    Species: Nitrosomonas europaea [TaxId:915]
    Gene: NE0167
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6ce_
  • Chain 'F':
    Compound: Uncharacterized protein NE0167
    Species: Nitrosomonas europaea [TaxId:915]
    Gene: NE0167
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6cf_
  • Chain 'G':
    Compound: Uncharacterized protein NE0167
    Species: Nitrosomonas europaea [TaxId:915]
    Gene: NE0167
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6cg_
  • Chain 'H':
    Compound: Uncharacterized protein NE0167
    Species: Nitrosomonas europaea [TaxId:915]
    Gene: NE0167
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6ch_
  • Chain 'I':
    Compound: Uncharacterized protein NE0167
    Species: Nitrosomonas europaea [TaxId:915]
    Gene: NE0167
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6ci_
  • Chain 'J':
    Compound: Uncharacterized protein NE0167
    Species: Nitrosomonas europaea [TaxId:915]
    Gene: NE0167
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k6cj_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k6cA (A:)
    mandgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdee
    kehaamllewirrcdpafdkelkdylftnkpiahe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6cA (A:)
    dgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeekeh
    aamllewirrcdpafdkelkdylftnkpiah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k6cB (B:)
    mandgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdee
    kehaamllewirrcdpafdkelkdylftnkpiahe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6cB (B:)
    dgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeekeh
    aamllewirrcdpafdkelkdylftnkpia
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3k6cC (C:)
    mandgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdee
    kehaamllewirrcdpafdkelkdylftnkpiahe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6cC (C:)
    dgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeekeh
    aamllewirrcdpafdkelkdylftnkpiah
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3k6cD (D:)
    mandgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdee
    kehaamllewirrcdpafdkelkdylftnkpiahe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6cD (D:)
    dgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeekeh
    aamllewirrcdpafdkelkdylftnkpiahe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3k6cE (E:)
    mandgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdee
    kehaamllewirrcdpafdkelkdylftnkpiahe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6cE (E:)
    dgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeekeh
    aamllewirrcdpafdkelkdylftnkpiah
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3k6cF (F:)
    mandgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdee
    kehaamllewirrcdpafdkelkdylftnkpiahe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6cF (F:)
    dgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeekeh
    aamllewirrcdpafdkelkdylftnkpiah
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3k6cG (G:)
    mandgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdee
    kehaamllewirrcdpafdkelkdylftnkpiahe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6cG (G:)
    ndgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeeke
    haamllewirrcdpafdkelkdylftnkpia
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3k6cH (H:)
    mandgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdee
    kehaamllewirrcdpafdkelkdylftnkpiahe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6cH (H:)
    dgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeekeh
    aamllewirrcdpafdkelkdylftnkpiah
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3k6cI (I:)
    mandgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdee
    kehaamllewirrcdpafdkelkdylftnkpiahe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6cI (I:)
    dgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeekeh
    aamllewirrcdpafdkelkdylftnkpiah
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3k6cJ (J:)
    mandgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdee
    kehaamllewirrcdpafdkelkdylftnkpiahe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k6cJ (J:)
    dgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeekeh
    aamllewirrcdpafdkelkdylftnkpia