PDB entry 3k67

View 3k67 on RCSB PDB site
Description: Crystal structure of protein af1124 from archaeoglobus fulgidus
Class: structural genomics, unknown function
Keywords: hypothetical protein af1124, structural genomics, psi, protein structure initiative, midwest center for structural genomics, mcsg, unknown function
Deposited on 2009-10-08, released 2009-10-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.147
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative dehydratase AF1124
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_1124
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3k67a_
  • Chain 'B':
    Compound: putative dehydratase AF1124
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_1124
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3k67b_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k67A (A:)
    mgggevkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglis
    gdlnpvhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigd
    vvrvegvvsgveknrytidvkcytgdkvvaegvvkvliw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k67A (A:)
    gevkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglisgdl
    npvhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigdvvr
    vegvvsgveknrytidvkcytgdkvvaegvvkvliw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k67B (B:)
    mgggevkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglis
    gdlnpvhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigd
    vvrvegvvsgveknrytidvkcytgdkvvaegvvkvliw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k67B (B:)
    gevkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglisgdl
    npvhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigdvvr
    vegvvsgveknrytidvkcytgdkvvaegvvkvliw