PDB entry 3k5s

View 3k5s on RCSB PDB site
Description: Crystal structure of chicken T-cadherin EC1 EC2
Class: Structural Protein
Keywords: Cadherin, calcium, cell adhesion, Alternative splicing, Cell membrane, Cleavage on pair of basic residues, Glycoprotein, GPI-anchor, Lipoprotein, Membrane, Structural Protein
Deposited on 2009-10-07, released 2010-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.213
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cadherin-13
    Species: Gallus gallus [TaxId:9031]
    Gene: Cdh13
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33150 (1-216)
      • expression tag (0)
      • conflict (73)
    Domains in SCOPe 2.08: d3k5sa1, d3k5sa2, d3k5sa3
  • Chain 'B':
    Compound: cadherin-13
    Species: Gallus gallus [TaxId:9031]
    Gene: Cdh13
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33150 (1-216)
      • expression tag (0)
      • conflict (73)
    Domains in SCOPe 2.08: d3k5sb1, d3k5sb2, d3k5sb3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3k5sA (A:)
silatpilipenqrppfprsvgkvirsegtegakfrlsgkgvdqdpkgifrineisgdvs
vtrpldreaianyqlevevtdlsgkiidgpvrldisvidqndnrpmfkegpyvghvmegs
ptgttvmrmtafdaddpstdnallrynilkqtptkpspnmfyidpekgdivtvvspvlld
retmetpkyelvieakdmgghdvgltgtatatilidd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3k5sB (B:)
silatpilipenqrppfprsvgkvirsegtegakfrlsgkgvdqdpkgifrineisgdvs
vtrpldreaianyqlevevtdlsgkiidgpvrldisvidqndnrpmfkegpyvghvmegs
ptgttvmrmtafdaddpstdnallrynilkqtptkpspnmfyidpekgdivtvvspvlld
retmetpkyelvieakdmgghdvgltgtatatilidd