PDB entry 3k5k

View 3k5k on RCSB PDB site
Description: Discovery of a 2,4-Diamino-7-aminoalkoxy-quinazoline as a Potent Inhibitor of Histone Lysine Methyltransferase, G9a
Class: transferase
Keywords: Histone Lysine Methyltransferase, G9A, ANK repeat, Chromatin regulator, Metal-binding, Methyltransferase, Nucleus, Phosphoprotein, S-adenosyl-L-methionine, Transferase, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2009-10-07, released 2009-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase, H3 lysine-9 specific 3
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT2, BAT8, C6orf30, G9A, KMT1C, NG36
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k5ka_
  • Chain 'B':
    Compound: Histone-lysine N-methyltransferase, H3 lysine-9 specific 3
    Species: Homo sapiens [TaxId:9606]
    Gene: EHMT2, BAT8, C6orf30, G9A, KMT1C, NG36
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k5kb_
  • Heterogens: ZN, SAH, DXQ, CL, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k5kA (A:)
    gsnrairtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnith
    lqhctcvddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknr
    vvqsgikvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdld
    nkdgevycidaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeel
    gfdygdrfwdikskyftcqcgsekckhsaeaialeqsrlarld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k5kA (A:)
    rtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctc
    vddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgi
    kvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkevyc
    idaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrf
    wdikskyftcqcgsekckhsaeaialeqsrla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k5kB (B:)
    gsnrairtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnith
    lqhctcvddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknr
    vvqsgikvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdld
    nkdgevycidaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeel
    gfdygdrfwdikskyftcqcgsekckhsaeaialeqsrlarld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k5kB (B:)
    ekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcvd
    dcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgikv
    rlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnevycida
    ryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwdi
    kskyftcqcgsekckhsaeaialeqsrla