PDB entry 3k5b

View 3k5b on RCSB PDB site
Description: Crystal structure of the peripheral stalk of Thermus thermophilus H+-ATPase/synthase
Class: hydrolase
Keywords: right handed coiled coil, vacuolar ATPase/synthase, V-Type ATPase/synthase, A-Type ATPase/synthase, peripheral stator, peripheral stalk, ATP synthesis, Hydrogen ion transport, Ion transport, Transport, HYDROLASE
Deposited on 2009-10-07, released 2010-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.235
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: V-type ATP synthase subunit E
    Species: Thermus thermophilus [TaxId:300852]
    Gene: 55981245, atpE, TTHA1276, vatE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74901 (Start-187)
      • engineered (133)
      • engineered (170)
      • engineered (177)
    Domains in SCOPe 2.07: d3k5ba1, d3k5ba2
  • Chain 'B':
    Compound: V-type ATP synthase, subunit (VAPC-THERM)
    Species: Thermus thermophilus [TaxId:300852]
    Gene: 55981248, TTHA1279
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k5bb_
  • Chain 'E':
    Compound: V-type ATP synthase subunit E
    Species: Thermus thermophilus [TaxId:300852]
    Gene: 55981245, atpE, TTHA1276, vatE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74901 (Start-187)
      • engineered (133)
      • engineered (170)
      • engineered (177)
    Domains in SCOPe 2.07: d3k5be1, d3k5be2
  • Chain 'G':
    Compound: V-type ATP synthase, subunit (VAPC-THERM)
    Species: Thermus thermophilus [TaxId:300852]
    Gene: 55981248, TTHA1279
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k5bg_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k5bA (A:)
    mskleailsqeveaeiqallqeaeakaeavkreaeekakallqareraleaqyraalrra
    esagellvatartqargevleevrrrvrealealpqkpewpevvrklalealealpgaka
    lvanpedlphleamarergvelqaepalrlgvravgaegktqvensllarmdrawdamss
    kvaqalwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k5bA (A:)
    skleailsqeveaeiqallqeaeakaeavkreaeekakallqareraleaqyraalrrae
    sagellvatartqargevleevrrrvrealealpqkpewpevvrklalealealpgakal
    vanpedlphleamarergvelqaeprlgvravgaegktqvensllarmdrawdamsskva
    qalwg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k5bB (B:)
    ggglglikslaekekqllerleaakkeaeervkraeaeakalleeaeakakaleaqyrer
    eraeteallaryreraeaeakavrekamarldeavalvlkevlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k5bB (B:)
    glikslaekekqllerleaakkeaeervkraeaeakalleeaeakakaleaqyrererae
    teallaryreraeaeakavrekamarldeavalvlkevlp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3k5bE (E:)
    mskleailsqeveaeiqallqeaeakaeavkreaeekakallqareraleaqyraalrra
    esagellvatartqargevleevrrrvrealealpqkpewpevvrklalealealpgaka
    lvanpedlphleamarergvelqaepalrlgvravgaegktqvensllarmdrawdamss
    kvaqalwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k5bE (E:)
    kleailsqeveaeiqallqeaeakaeavkreaeekakallqareraleaqyraalrraes
    agellvatartqargevleevrrrvrealealpqkpewpevvrklalealealpgakalv
    anpedlphleamarergvelepalrlgvravgaegktqvensllarmdrawdamsskvaq
    alwg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3k5bG (G:)
    ggglglikslaekekqllerleaakkeaeervkraeaeakalleeaeakakaleaqyrer
    eraeteallaryreraeaeakavrekamarldeavalvlkevlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k5bG (G:)
    glikslaekekqllerleaakkeaeervkraeaeakalleeaeakakaleaqyrererae
    teallaryreraeaeakavrekamarldeavalvlkevlp