PDB entry 3k54

View 3k54 on RCSB PDB site
Description: Structures of human Bruton's tyrosine kinase in active and inactive conformations suggests a mechanism of activation for TEC family kinases.
Class: transferase
Keywords: Bruton's tyrosine kinase, BTK, Dasatinib, ATP-binding, Disease mutation, Kinase, Membrane, Metal-binding, Nucleotide-binding, Nucleus, Phosphoprotein, Transferase, Tyrosine-protein kinase
Deposited on 2009-10-06, released 2010-01-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: AGMX1, ATK, BPK, BTK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3k54a_
  • Heterogens: 1N1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k54A (A:)
    gplgsknapstaglgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegs
    msedefieeakvmmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtq
    qllemckdvceameyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeetssvg
    skfpvrwsppevlmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrl
    yrphlasekvytimyscwhekaderptfkillsnildvmdees
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k54A (A:)
    ygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikefieeakvmmnlsheklv
    qlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyleskqfl
    hrdlaarnclvndqgvvkvsdfgfpvrwsppevlmyskfssksdiwafgvlmweiyslgk
    mpyerftnsetaehiaqglrlyrphlasekvytimyscwhekaderptfkillsnildvm
    dee