PDB entry 3k4x

View 3k4x on RCSB PDB site
Description: Eukaryotic Sliding Clamp PCNA Bound to DNA
Class: DNA binding protein/DNA
Keywords: DNA replication, DNA-binding, clamp loader, DNA sliding clamp, DNA BINDING PROTEIN-DNA complex
Deposited on 2009-10-06, released 2010-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: POL30, YBR088C, YBR0811
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k4xa1, d3k4xa2, d3k4xa3, d3k4xa4, d3k4xa5, d3k4xa6
  • Chain 'B':
    Compound: DNA (5'-d(*cp*cp*cp*ap*tp*cp*gp*tp*ap*t)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*tp*tp*tp*tp*ap*tp*ap*cp*gp*ap*tp*gp*gp*g)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k4xA (A:)
    gphmasmleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigv
    eafqeyrcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaey
    slklmdidadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgd
    igsgsviikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseap
    alfqfdlksgflqfflapkfndegsnsqsngsgaleakfeeaslfkriidgfkdcvqlvn
    fqckedgiiaqavddsrvllvsleigveafqeyrcdhpvtlgmdltslskilrcgnntdt
    ltliadntpdsiillfedtkkdriaeyslklmdidadflkieelqydstlslpssefski
    vrdlsqlsdsinimitketikfvadgdigsgsviikpfvdmehpetsiklemdqpvdltf
    gakylldiikgsslsdrvgirlsseapalfqfdlksgflqfflapkfndegsnsqasnsg
    aleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkfndee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k4xA (A:)
    leakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqeyr
    cdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmdi
    dadflkieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsvi
    ikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdl
    ksgflqfflapkleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvs
    leigveafqeyrcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkd
    riaeyslklmdidadflkieelqydstlslpssefskivrdlsqlsdsinimitketikf
    vadgdigsgsviikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirl
    sseapalfqfdlksgflqfflapkfnleakfeeaslfkriidgfkdcvqlvnfqckedgi
    iaqavddsrvllvsleigveafqeyrcdhpvtlgmdltslskilrcgnntdtltliadnt
    pdsiillfedtkkdriaeyslklmdidadflkieelqydstlslpssefskivrdlsqls
    dsinimitketikfvadgdigsgsviikpfvdmehpetsiklemdqpvdltfgakylldi
    ikgsslsdrvgirlsseapalfqfdlksgflqfflapk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.