PDB entry 3k4v

View 3k4v on RCSB PDB site
Description: New crystal form of HIV-1 Protease/Saquinavir structure reveals carbamylation of N-terminal proline
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR COMPLEX, CARBAMYLATION, AIDS, Aspartyl protease, Capsid maturation, Capsid protein,
Deposited on 2009-10-06, released 2010-06-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.159
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1 [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (1-99)
      • see remark 999 (0)
      • engineered (7)
      • engineered (33)
      • engineered (63)
      • engineered (67)
      • engineered (95)
    Domains in SCOPe 2.02: d3k4va_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1 [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (1-99)
      • see remark 999 (0)
      • engineered (7)
      • engineered (33)
      • engineered (63)
      • engineered (67)
      • engineered (95)
    Domains in SCOPe 2.02: d3k4vb_
  • Chain 'C':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1 [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.02: d3k4vc_
  • Chain 'D':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1 [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.02: d3k4vd_
  • Heterogens: DMS, ROC, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3k4vA (A:)
xpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqy
dqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3k4vB (B:)
xpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqy
dqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3k4vC (C:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3k4vD (D:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf