PDB entry 3k4v
View 3k4v on RCSB PDB site
Description: New crystal form of HIV-1 Protease/Saquinavir structure reveals carbamylation of N-terminal proline
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR COMPLEX, CARBAMYLATION, AIDS, Aspartyl protease, Capsid maturation, Capsid protein,
Deposited on
2009-10-06, released
2010-06-09
The last revision prior to the SCOPe 2.02 freeze date was dated
2011-12-07, with a file datestamp of
2011-12-02.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.159
AEROSPACI score: 0.71
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus type 1 [TaxId:11678]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03366 (1-99)
- see remark 999 (0)
- engineered (7)
- engineered (33)
- engineered (63)
- engineered (67)
- engineered (95)
Domains in SCOPe 2.02: d3k4va_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus type 1 [TaxId:11678]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03366 (1-99)
- see remark 999 (0)
- engineered (7)
- engineered (33)
- engineered (63)
- engineered (67)
- engineered (95)
Domains in SCOPe 2.02: d3k4vb_ - Chain 'C':
Compound: hiv-1 protease
Species: Human immunodeficiency virus type 1 [TaxId:11678]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03366 (0-98)
- engineered (6)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (94)
Domains in SCOPe 2.02: d3k4vc_ - Chain 'D':
Compound: hiv-1 protease
Species: Human immunodeficiency virus type 1 [TaxId:11678]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03366 (0-98)
- engineered (6)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (94)
Domains in SCOPe 2.02: d3k4vd_ - Heterogens: DMS, ROC, CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3k4vA (A:)
xpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqy
dqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3k4vB (B:)
xpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqy
dqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3k4vC (C:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>3k4vD (D:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf