PDB entry 3k4p

View 3k4p on RCSB PDB site
Description: Aspergillus niger Phytase
Class: hydrolase
Keywords: Phytase, PhyA, 3-Phosphotase, myo-inositol hexakis phosphate phosphohydrolase, 37288-11-2, Disulfide bond, Glycoprotein, Hydrolase, Secreted
Deposited on 2009-10-06, released 2010-06-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phytase A
    Species: Aspergillus niger [TaxId:5061]
    Gene: PHYA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3k4pa_
  • Chain 'B':
    Compound: 3-phytase A
    Species: Aspergillus niger [TaxId:5061]
    Gene: PHYA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3k4pb_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k4pA (A:)
    asrnqsscdtvdqgyqcfsetshlwgqyapffslanesvispevpagcrvtfaqvlsrhg
    aryptdskgkkysalieeiqqnattfdgkyaflktynyslgaddltpfgeqelvnsgikf
    yqryesltrnivpfirssgssrviasgkkfiegfqstklkdpraqpgqsspkidvvisea
    sssnntldpgtctvfedseladtveanftatfvpsirqrlendlsgvtltdtevtylmdm
    csfdtiststvdtklspfcdlfthdewinydylqslkkyyghgagnplgptqgvgyanel
    iarlthspvhddtssnhtldsspatfplnstlyadfshdngiisilfalglyngtkplst
    ttvenitqtdgfssawtvpfasrlyvemmqcqaeqeplvrvlvndrvvplhgcpvdalgr
    ctrdsfvrglsfarsggdwaecfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k4pA (A:)
    scdtvdqgyqcfsetshlwgqyapffslanesvispevpagcrvtfaqvlsrhgaryptd
    skgkkysalieeiqqnattfdgkyaflktynyslgaddltpfgeqelvnsgikfyqryes
    ltrnivpfirssgssrviasgkkfiegfqstklkdpraqpgqsspkidvviseasssnnt
    ldpgtctvfedseladtveanftatfvpsirqrlendlsgvtltdtevtylmdmcsfdti
    ststvdtklspfcdlfthdewinydylqslkkyyghgagnplgptqgvgyaneliarlth
    spvhddtssnhtldsspatfplnstlyadfshdngiisilfalglyngtkplstttveni
    tqtdgfssawtvpfasrlyvemmqcqaeqeplvrvlvndrvvplhgcpvdalgrctrdsf
    vrglsfarsggdwaecfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k4pB (B:)
    asrnqsscdtvdqgyqcfsetshlwgqyapffslanesvispevpagcrvtfaqvlsrhg
    aryptdskgkkysalieeiqqnattfdgkyaflktynyslgaddltpfgeqelvnsgikf
    yqryesltrnivpfirssgssrviasgkkfiegfqstklkdpraqpgqsspkidvvisea
    sssnntldpgtctvfedseladtveanftatfvpsirqrlendlsgvtltdtevtylmdm
    csfdtiststvdtklspfcdlfthdewinydylqslkkyyghgagnplgptqgvgyanel
    iarlthspvhddtssnhtldsspatfplnstlyadfshdngiisilfalglyngtkplst
    ttvenitqtdgfssawtvpfasrlyvemmqcqaeqeplvrvlvndrvvplhgcpvdalgr
    ctrdsfvrglsfarsggdwaecfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k4pB (B:)
    scdtvdqgyqcfsetshlwgqyapffslanesvispevpagcrvtfaqvlsrhgaryptd
    skgkkysalieeiqqnattfdgkyaflktynyslgaddltpfgeqelvnsgikfyqryes
    ltrnivpfirssgssrviasgkkfiegfqstklkdpraqpgqsspkidvviseasssnnt
    ldpgtctvfedseladtveanftatfvpsirqrlendlsgvtltdtevtylmdmcsfdti
    ststvdtklspfcdlfthdewinydylqslkkyyghgagnplgptqgvgyaneliarlth
    spvhddtssnhtldsspatfplnstlyadfshdngiisilfalglyngtkplstttveni
    tqtdgfssawtvpfasrlyvemmqcqaeqeplvrvlvndrvvplhgcpvdalgrctrdsf
    vrglsfarsggdwaecfa