SCOPe 2.08: Structural Classification of Proteins

PDB entry 3k4g

View 3k4g on RCSB PDB site
Description: Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
Class: transferase
Keywords: BACTERIAL TRANSCRIPTION REGULATION, DNA-directed RNA polymerase, Nucleotidyltransferase, Transcription, Transferase
Deposited on 2009-10-05, released 2010-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: DNA-directed RNA polymerase subunit alpha
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b3295, JW3257, pez, phs, rpoA, sez
Database cross-references and differences (RAF-indexed):
- Uniprot P0A7Z4 (Start-85)
Domains in SCOPe 2.08: d3k4ga_
Chain 'B':
Compound: DNA-directed RNA polymerase subunit alpha
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b3295, JW3257, pez, phs, rpoA, sez
Database cross-references and differences (RAF-indexed):
- Uniprot P0A7Z4
Domains in SCOPe 2.08: d3k4gb_
Chain 'C':
Compound: DNA-directed RNA polymerase subunit alpha
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b3295, JW3257, pez, phs, rpoA, sez
Database cross-references and differences (RAF-indexed):
- Uniprot P0A7Z4 (Start-85)
Domains in SCOPe 2.08: d3k4gc_
Chain 'D':
Compound: DNA-directed RNA polymerase subunit alpha
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b3295, JW3257, pez, phs, rpoA, sez
Database cross-references and differences (RAF-indexed):
- Uniprot P0A7Z4
Domains in SCOPe 2.08: d3k4gd_
Chain 'E':
Compound: DNA-directed RNA polymerase subunit alpha
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b3295, JW3257, pez, phs, rpoA, sez
Database cross-references and differences (RAF-indexed):
- Uniprot P0A7Z4
Domains in SCOPe 2.08: d3k4ge_
Chain 'F':
Compound: DNA-directed RNA polymerase subunit alpha
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b3295, JW3257, pez, phs, rpoA, sez
Database cross-references and differences (RAF-indexed):
- Uniprot P0A7Z4 (Start-85)
Domains in SCOPe 2.08: d3k4gf_
Chain 'G':
Compound: DNA-directed RNA polymerase subunit alpha
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b3295, JW3257, pez, phs, rpoA, sez
Database cross-references and differences (RAF-indexed):
- Uniprot P0A7Z4 (Start-85)
Domains in SCOPe 2.08: d3k4gg_
Chain 'H':
Compound: DNA-directed RNA polymerase subunit alpha
Species: Escherichia coli K-12 [TaxId:83333]
Gene: b3295, JW3257, pez, phs, rpoA, sez
Database cross-references and differences (RAF-indexed):
- Uniprot P0A7Z4
Domains in SCOPe 2.08: d3k4gh_
Heterogens: NA, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3k4gA (A:)
mekpefdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkksltei
kdvlasrglslgmrlenwppasiade