PDB entry 3k48

View 3k48 on RCSB PDB site
Description: Crystal structure of APRIL bound to a peptide
Class: cytokine
Keywords: cytokine, TNFSF, Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Immune response, Secreted
Deposited on 2009-10-05, released 2009-11-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.212
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 13
    Species: Mus musculus [TaxId:10090]
    Gene: April, TNFSF 13, Tnfsf13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3k48a_
  • Chain 'B':
    Compound: Tumor necrosis factor ligand superfamily member 13
    Species: Mus musculus [TaxId:10090]
    Gene: April, TNFSF 13, Tnfsf13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3k48b_
  • Chain 'D':
    Compound: Tumor necrosis factor ligand superfamily member 13
    Species: Mus musculus [TaxId:10090]
    Gene: April, TNFSF 13, Tnfsf13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3k48d_
  • Chain 'R':
    Compound: peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3K48 (0-15)
  • Chain 'S':
    Compound: peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3K48
  • Chain 'T':
    Compound: peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3K48

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k48A (A:)
    gskkhsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvl
    fhdvtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkip
    ranaklslsphgtflgfvkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k48A (A:)
    khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
    vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
    aklslsphgtflgfvkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k48B (B:)
    gskkhsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvl
    fhdvtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkip
    ranaklslsphgtflgfvkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k48B (B:)
    khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
    vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
    aklslsphgtflgfvkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3k48D (D:)
    gskkhsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvl
    fhdvtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkip
    ranaklslsphgtflgfvkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k48D (D:)
    khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
    vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
    aklslsphgtflgfvkl
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.