PDB entry 3k47

View 3k47 on RCSB PDB site
Description: Alternate Binding Modes Observed for the E- and Z-Isomers of 2,4-Diaminofuro[2,3-d]pyrimidines as Ternary Complexes with NADPH and Mouse Dihydrofolate Reductase
Class: oxidoreductase
Keywords: mouse dihydrofolate reductase cofactor ligand complex, nadp, one-carbon metabolism, oxidoreductase
Deposited on 2009-10-05, released 2009-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.191
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Mus musculus [TaxId:10090]
    Gene: Dhfr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k47a_
  • Heterogens: D09, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3k47A (A:)
vrplncivavsqnmgigkngdlpwpplrnefkyfqrmtttssvegkqnlvimgrktwfsi
peknrplkdrinivlsrelkepprgahflakslddalrlieqpelaskvdmvwivggssv
yqeamnqpghlrlfvtrimqefesdtffpeidlgkykllpeypgvlsevqeekgikykfe
vyekkd