PDB entry 3k45

View 3k45 on RCSB PDB site
Description: Alternate Binding Modes Observed for the E- and Z-isomers of 2,4-Diaminofuro[2,3d]pyrimidines as Ternary Complexes with NADPH and Mouse Dihydrofolate Reductase
Class: oxidoreductase
Keywords: protein ligand cofactor ternary complex, nadp, one-carbon metabolism, oxidoreductase
Deposited on 2009-10-05, released 2009-10-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.198
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Mus musculus [TaxId:10090]
  Gene: Dhfr
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00375 (0-185)
    • conflict (103)
  Domains in SCOPe 2.01: d3k45a_
• Heterogens: NDP, 51P, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3k45A (A:)
  vrplncivavsqnmgigkngdlpwpplrnefkyfqrmtttssvegkqnlvimgrktwfsi
  peknrplkdrinivlsrelkepprgahflakslddalrlieqpdlaskvdmvwivggssv
  yqeamnqpghlrlfvtrimqefesdtffpeidlgkykllpeypgvlsevqeekgikykfe
  vyekkd