PDB entry 3k40

View 3k40 on RCSB PDB site
Description: Crystal structure of Drosophila 3,4-dihydroxyphenylalanine decarboxylase
Class: lyase
Keywords: PLP dependent protein, alpha beta protein, Alternative splicing, Catecholamine biosynthesis, Decarboxylase, Lyase, Polymorphism, Pyridoxal phosphate, CG10697-PB isoform B
Deposited on 2009-10-05, released 2010-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.198
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aromatic-L-amino-acid decarboxylase
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG10697, Ddc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k40a_
  • Chain 'B':
    Compound: Aromatic-L-amino-acid decarboxylase
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG10697, Ddc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3k40b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k40A (A:)
    meapefkdfaktmvdfiaeylenirerrvlpevkpgylkplipdaapekpekwqdvmqdi
    ervimpgvthwhspkfhayfptansypaivadmlsgaiacigftwiaspactelevvmmd
    wlgkmlelpaeflacsggkgggviqgtasestlvallgakakklkevkelhpewdehtil
    gklvgycsdqahssveragllggvklrsvqsenhrmrgaalekaieqdvaeglipfyavv
    tlgttnscafdyldecgpvgnkhnlwihvdaayagsaficpeyrhlmkgiesadsfnfnp
    hkwmlvnfdcsamwlkdpswvvnafnvdplylkhdmqgsapdyrhwqiplgrrfralklw
    fvlrlygvenlqahirrhcnfakqfgdlcvadsrfelaaeinmglvcfrlkgsnerneal
    lkringrghihlvpakikdvyflrmaicsrftqsedmeyswkevsaaademeqeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k40A (A:)
    meapefkdfaktmvdfiaeylenirerrvlpevkpgylkplipdaapekpekwqdvmqdi
    ervimpgvthwhspkfhayfptansypaivadmlsgaiacigftwiaspactelevvmmd
    wlgkmlelpaeflacsggkgggviqgtasestlvallgakakklkevkelhpewdehtil
    gklvgycsdqahssveragllggvklrsvqsenhrmrgaalekaieqdvaeglipfyavv
    tlgttnscafdyldecgpvgnkhnlwihvdaayagsaficpeyrhlmkgiesadsfnfnp
    hkwmlvnfdcsamwlkdpswvplgrrfralklwfvlrlygvenlqahirrhcnfakqfgd
    lcvadsrfelaaeinmglvcfrlkgsnerneallkringrghihlvpakikdvyflrmai
    csrftqsedmeyswkevsaaademeqeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k40B (B:)
    meapefkdfaktmvdfiaeylenirerrvlpevkpgylkplipdaapekpekwqdvmqdi
    ervimpgvthwhspkfhayfptansypaivadmlsgaiacigftwiaspactelevvmmd
    wlgkmlelpaeflacsggkgggviqgtasestlvallgakakklkevkelhpewdehtil
    gklvgycsdqahssveragllggvklrsvqsenhrmrgaalekaieqdvaeglipfyavv
    tlgttnscafdyldecgpvgnkhnlwihvdaayagsaficpeyrhlmkgiesadsfnfnp
    hkwmlvnfdcsamwlkdpswvvnafnvdplylkhdmqgsapdyrhwqiplgrrfralklw
    fvlrlygvenlqahirrhcnfakqfgdlcvadsrfelaaeinmglvcfrlkgsnerneal
    lkringrghihlvpakikdvyflrmaicsrftqsedmeyswkevsaaademeqeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k40B (B:)
    meapefkdfaktmvdfiaeylenirerrvlpevkpgylkplipdaapekpekwqdvmqdi
    ervimpgvthwhspkfhayfptansypaivadmlsgaiacigftwiaspactelevvmmd
    wlgkmlelpaeflacsggkgggviqgtasestlvallgakakklkevkelhpewdehtil
    gklvgycsdqahssveragllggvklrsvqsenhrmrgaalekaieqdvaeglipfyavv
    tlgttnscafdyldecgpvgnkhnlwihvdaayagsaficpeyrhlmkgiesadsfnfnp
    hkwmlvnfdcsamwlkdpswvplgrrfralklwfvlrlygvenlqahirrhcnfakqfgd
    lcvadsrfelaaeinmglvcfrlkgsnerneallkringrghihlvpakikdvyflrmai
    csrftqsedmeyswkevsaaademeqeq