PDB entry 3k3q

View 3k3q on RCSB PDB site
Description: Crystal Structure of a Llama Antibody complexed with the C. Botulinum Neurotoxin Serotype A Catalytic Domain
Class: immune system
Keywords: llama, VHH, antibody, botulinum, neurotoxin, BoNT, Cell junction, Cell membrane, Cytoplasm, Disulfide bond, Hydrolase, Membrane, Metal-binding, Metalloprotease, Pharmaceutical, Protease, Secreted, Synapse, Toxin, Transmembrane, Zinc, IMMUNE SYSTEM
Deposited on 2009-10-04, released 2010-02-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: llama Aa1 VHH domain
    Species: Lama glama [TaxId:9844]
    Gene: llama VHH immunoglobulin
    Database cross-references and differences (RAF-indexed):
    • PDB 3K3Q
    Domains in SCOPe 2.01: d3k3qa_
  • Chain 'B':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum A str. Hall [TaxId:441771]
    Gene: botA, CBO0806, CLC_0862, neurotoxin catalytic domain
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5HZZ9 (4-251)
      • expression tag (3)
      • see remark 999 (28)
  • Chain 'C':
    Compound: Botulinum neurotoxin type A
    Species: Clostridium botulinum A str. Hall [TaxId:441771]
    Gene: botA, CBO0806, CLC_0862, neurotoxin catalytic domain
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3k3qA (A:)
mdiavqlvdsgggtlqagkslrlscaisglafdggamgsehrltagamgwfrqapgkdre
fvaaisprtdetyyaeslegrfsvsrdaaatmvflqadnvrlddtasyycaadedvtprv
mgviphadhwgqgtlvtvssaaalehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3k3qA (A:)
avqlvdsgggtlqagkslrlscaisglafdggamgsehrltagamgwfrqapgkdrefva
aisprtdetyyaeslegrfsvsrdaaatmvflqadnvrlddtasyycaadedvtprvmgv
iphadhwgqgtlvtvss

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.