PDB entry 3k3j

View 3k3j on RCSB PDB site
Description: P38alpha bound to novel DFG-out compound PF-00416121
Class: transferase
Keywords: p38alpha kinase, ATP-binding, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2009-10-02, released 2009-11-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3k3ja_
  • Heterogens: F4C, I46, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k3jA (A:)
    gsmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrp
    fqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivk
    cqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtdde
    mtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrl
    vgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkrit
    aaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeem
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3jA (A:)
    rptfyrqelnktiwevperyqnlspvgsggsvcaafdtktglrvavkklsrpfqsiihak
    rtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnikltddhvqfl
    iyqilrglkyihsadiihrdlkpsnlavnedcelkildfvatrwyrapeimlnwmhynqt
    vdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqslt
    qmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpy
    dqsfesrdllidewksltydevisfvppp