PDB entry 3k3i

View 3k3i on RCSB PDB site
Description: p38alpha bound to novel DGF-out compound PF-00215955
Class: transferase
Keywords: P38 Kinase, Alternative splicing, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase
Deposited on 2009-10-02, released 2009-11-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-12-08, with a file datestamp of 2009-12-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.196
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: CSBP, CSBP1, CSBP2, CSPB1, MAPK14, MXI2, P38
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3k3ia_
  • Heterogens: JZJ, I46, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k3iA (A:)
    gsrptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsi
    ihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkl
    tddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgy
    vatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtp
    gaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqa
    lahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3iA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnikltddhvq
    fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfgvatrwyrapeimlnwmhy
    nqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiq
    sltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepva
    dpydqsfesrdllidewksltydevisfvppp