PDB entry 3k3b

View 3k3b on RCSB PDB site
Description: Co-crystal structure of the human kinesin Eg5 with a novel tetrahydro-beta-carboline
Class: motor protein
Keywords: protein-ligand complex, ATP-binding, Cell cycle, Cell division, Microtubule, Mitosis, Motor protein, Nucleotide-binding, Phosphoprotein
Deposited on 2009-10-02, released 2009-12-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.207
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3k3ba_
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3k3bb_
  • Heterogens: MG, ADP, L31, NO3, CL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k3bA (A:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3bA (A:)
    gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas
    tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagi
    iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi
    ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeel
    vkigklnlvdlagseagninqslltlgrvitalvertphvpyreskltrilqdslggrtr
    tsiiatispaslnleetlstleyahraknilnkpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k3bB (B:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3bB (B:)
    gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtdkssrktytfdmvfgastkqi
    dvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiiprt
    lhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviikgl
    eeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvkig
    klnlvdlagsengninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsii
    atispaslnleetlstleyahraknilnkpe