PDB entry 3k3a

View 3k3a on RCSB PDB site
Description: Crystal Structure of B/Perth Neuraminidase D197E mutant in complex with Oseltamivir
Class: hydrolase
Keywords: INFLUENZA, NEURAMINIDASE, MUTATION, RESISTANCE, TAMIFLU, Oseltamivir, GS-4071, 196618-13-0, HYDROLASE, Cell membrane, Glycosidase, Membrane, Transmembrane, Virion
Deposited on 2009-10-02, released 2010-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.208
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3aa_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3ab_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3ac_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3ad_
  • Chain 'E':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3ae_
  • Chain 'F':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3af_
  • Chain 'G':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3ag_
  • Chain 'H':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3ah_
  • Chain 'I':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3ai_
  • Chain 'J':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3aj_
  • Chain 'K':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3ak_
  • Chain 'L':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3al_
  • Chain 'M':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3am_
  • Chain 'N':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3an_
  • Chain 'O':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3ao_
  • Chain 'P':
    Compound: Neuraminidase
    Species: Influenza B virus [TaxId:343983]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3S340 (Start-396)
      • engineered (127)
    Domains in SCOPe 2.07: d3k3ap_
  • Heterogens: NAG, CA, G39, YT3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k3aA (A:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aA (A:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k3aB (B:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aB (B:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3k3aC (C:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aC (C:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3k3aD (D:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aD (D:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3k3aE (E:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aE (E:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3k3aF (F:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aF (F:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3k3aG (G:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aG (G:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3k3aH (H:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aH (H:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3k3aI (I:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aI (I:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3k3aJ (J:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aJ (J:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3k3aK (K:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aK (K:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3k3aL (L:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aL (L:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3k3aM (M:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aM (M:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3k3aN (N:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aN (N:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3k3aO (O:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aO (O:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3k3aP (P:)
    gvtlllpepewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckh
    falthyaaqpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewt
    yigvdgpennallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgis
    ecrflkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvet
    dtaeirlmctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtm
    sktkrmgmglyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiem
    vhdggketwhsaataiyclmgsgqllwdtvtgvdmal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k3aP (P:)
    pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
    qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
    nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
    egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
    ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
    glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
    whsaataiyclmgsgqllwdtvtgvdmal