PDB entry 3k2u

View 3k2u on RCSB PDB site
Description: Crystal structure of HGFA in complex with the allosteric inhibitory antibody Fab40
Class: hydrolase/immune system
Keywords: Serine Protease, Allosteric inhibitor, Antibody, EGF-like domain, GLYCOPROTEIN, Fab complex, HYDROLASE, Disulfide bond, Kringle, Protease, Secreted, Zymogen, HYDROLASE-IMMUNE SYSTEM complex
Deposited on 2009-09-30, released 2009-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.239
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor activator long chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hepatocyte growth factor activator short chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Antibody, Fab fragment, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3K2U (0-End)
  • Chain 'L':
    Compound: Antibody, Fab fragment, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3K2U (0-213)
    Domains in SCOPe 2.07: d3k2ul1, d3k2ul2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >3k2uL (L:)
diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqsnrapatfgqgtkveikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgec

    Sequence, based on observed residues (ATOM records): (download) 
    >3k2uL (L:)
diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqsnrapatfgqgtkveikrtvaapsvfifpp
sdeqltasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdstyslsstltlskady
ekhkvyacevthqglsspvtksfnrgec