PDB entry 3k1z

View 3k1z on RCSB PDB site
Description: Crystal Structure of Human Haloacid Dehalogenase-like Hydrolase Domain containing 3 (HDHD3)
Class: hydrolase
Keywords: HDHD3, Haloacid Dehalogenase-like Hydrolase Domain containing 3, Structural Genomics, Structural Genomics Consortium, SGC, HYDROLASE
Deposited on 2009-09-29, released 2009-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haloacid dehalogenase-like hydrolase domain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: HDHD3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BSH5 (1-240)
      • expression tag (0)
    Domains in SCOPe 2.07: d3k1za1, d3k1za2
  • Heterogens: EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k1zA (A:)
    mrlltwdvkdtllrlrhplgeayatkarahglevepsaleqgfrqayraqshsfpnygls
    hgltsrqwwldvvlqtfhlagvqdaqavapiaeqlykdfshpctwqvldgaedtlrecrt
    rglrlavisnfdrrlegilgglglrehfdfvltseaagwpkpdprifqealrlahmepvv
    aahvgdnylcdyqgpravgmhsflvvgpqaldpvvrdsvpkehilpslahllpaldcleg
    saenlyfqshhhhhhdykddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k1zA (A:)
    mrlltwdvkdtllrlrhplgeayatkarahglevepsaleqgfrqayraqshsfpnygls
    hgltsrqwwldvvlqtfhlagvqdaqavapiaeqlykdfshpctwqvldgaedtlrecrt
    rglrlavisnfdrrlegilgglglrehfdfvltseaagwpkpdprifqealrlahmepvv
    aahvgdnylcdyqgpravgmhsflvvgpqaldpvvrdsvpkehilpslahllpaldcleg
    s