PDB entry 3k1i

View 3k1i on RCSB PDB site
Description: Crystal strcture of FliS-HP1076 complex in H. pylori
Class: chaperone
Keywords: Co-chaperone, chaperone, flagellar system, Helicobacter pylori, Flagellum
Deposited on 2009-09-28, released 2010-06-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.26
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellar protein
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: HP_0753
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3k1ia_
  • Chain 'B':
    Compound: Flagellar protein
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: HP_0753
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3k1ib_
  • Chain 'C':
    Compound: Putative uncharacterized protein
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: HP_1076
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Putative uncharacterized protein
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: HP_1076
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k1iA (A:)
    gplgsmqyanayqayqhnrvsvespakliemlyegilrfssqakrcienediekkiyyin
    rvtdiftellnildyekggevavyltglythqikvltqanvendaskidlvlnvarglle
    awreihsdela
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k1iA (A:)
    spakliemlyegilrfssqakrcienediekkiyyinrvtdiftellnildyekggevav
    yltglythqikvltqanvendaskidlvlnvarglleawreihsde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k1iB (B:)
    gplgsmqyanayqayqhnrvsvespakliemlyegilrfssqakrcienediekkiyyin
    rvtdiftellnildyekggevavyltglythqikvltqanvendaskidlvlnvarglle
    awreihsdela
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k1iB (B:)
    spakliemlyegilrfssqakrcienediekkiyyinrvtdiftellnildyekggevav
    yltglythqikvltqanvendaskidlvlnvarglleawreihs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.