PDB entry 3k1e

View 3k1e on RCSB PDB site
Description: Crystal structure of odorant binding protein 1 (AaegOBP1) from Aedes aegypti
Class: odorant binding protein
Keywords: Insect odorant binding protein fold, ODORANT BINDING PROTEIN
Deposited on 2009-09-27, released 2009-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.154
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: odorant binding protein
    Species: Aedes aegypti [TaxId:7159]
    Gene: AAEL009449
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3k1ea_
  • Chain 'B':
    Compound: odorant binding protein
    Species: Aedes aegypti [TaxId:7159]
    Gene: AAEL009449
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3k1eb_
  • Heterogens: MG, PEU, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k1eA (A:)
    dvtprrdaeypppefleamkplreicikktgvteeaiiefsdgkvhedenlkcymnclfh
    eakvvddtghvhleklhdalpdsmhdialhmgkrclypegenlcekafwlhkcwkesdpk
    hyfli
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k1eA (A:)
    vtprrdaeypppefleamkplreicikktgvteeaiiefsdgkvhedenlkcymnclfhe
    akvvddtghvhleklhdalpdsmhdialhmgkrclypegenlcekafwlhkcwkesdpkh
    yfli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k1eB (B:)
    dvtprrdaeypppefleamkplreicikktgvteeaiiefsdgkvhedenlkcymnclfh
    eakvvddtghvhleklhdalpdsmhdialhmgkrclypegenlcekafwlhkcwkesdpk
    hyfli
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k1eB (B:)
    ypppefleamkplreicikktgvteeaiiefsdgkvhedenlkcymnclfheakvvddtg
    hvhleklhdalpdsmhdialhmgkrclypegenlcekafwlhkcwkesdpkhyfli