PDB entry 3k0j

View 3k0j on RCSB PDB site
Description: Crystal structure of the E. coli ThiM riboswitch in complex with thiamine pyrophosphate and the U1A crystallization module
Class: RNA/RNA binding protein
Keywords: riboswitch, RNA, thi-box, ThiM, U1A protein, Acetylation, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, Ribonucleoprotein, RNA-binding, Spliceosome, RNA/RNA BINDING PROTEIN COMPLEX
Deposited on 2009-09-24, released 2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-01-12, with a file datestamp of 2010-01-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.197
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA, U1A protein
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (29)
      • engineered (34)
    Domains in SCOPe 2.06: d3k0ja_
  • Chain 'B':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA, U1A protein
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (29)
      • engineered (34)
    Domains in SCOPe 2.06: d3k0jb_
  • Chain 'C':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA, U1A protein
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (29)
      • engineered (34)
    Domains in SCOPe 2.06: d3k0jc_
  • Chain 'D':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA, U1A protein
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (29)
      • engineered (34)
    Domains in SCOPe 2.06: d3k0jd_
  • Chain 'E':
    Compound: RNA (87-mer)
  • Chain 'F':
    Compound: RNA (87-mer)
  • Heterogens: TPP, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3k0jA (A:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k0jA (A:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3k0jB (B:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k0jB (B:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3k0jC (C:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k0jC (C:)
    petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
    satnalrsmqgfpfydkpmriqyakt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3k0jD (D:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3k0jD (D:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrsmrgqafvifkevssatn
    alrsmqgfpfydkpmriqyakt
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.