PDB entry 3jzs

View 3jzs on RCSB PDB site
Description: Human MDM2 liganded with a 12mer peptide inhibitor (pDIQ)
Class: ligase
Keywords: P53-BINDING PROTEIN MDM2, ONCOPROTEIN MDM2, DOUBLE MINUTE 2 PROTEIN, HDM2, Alternative splicing, Cytoplasm, Host-virus interaction, Ligase, Metal-binding, Nucleus, Phosphoprotein, Proto-oncogene, Ubl conjugation, Ubl conjugation pathway, Zinc, Zinc-finger
Deposited on 2009-09-24, released 2009-11-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.215
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: E3 ubiquitin-protein ligase Mdm2
  Species: Homo sapiens [TaxId:9606]
  Gene: MDM2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00987
  Domains in SCOPe 2.03: d3jzsa_
• Chain 'P':
  Compound: pDIQ peptide (12mer)
  Database cross-references and differences (RAF-indexed):
  • PDB 3JZS (0-11)
• Heterogens: EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3jzsA (A:)
  qetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllg
  dlfgvpsfsvkehrkiytmiyrnlvv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3jzsA (A:)
  tlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgdl
  fgvpsfsvkehrkiytmiyrnlv
  

  
  
• Chain 'P':
  No sequence available.