PDB entry 3jzr

View 3jzr on RCSB PDB site
Description: Human MDM2 liganded with a 12mer peptide inhibitor (pDI6W)
Class: ligase
Keywords: P53-BINDING PROTEIN MDM2, ONCOPROTEIN MDM2, DOUBLE MINUTE 2 PROTEIN, HDM2, Alternative splicing, Cytoplasm, Host-virus interaction, Ligase, Metal-binding, Nucleus, Phosphoprotein, Proto-oncogene, Ubl conjugation, Ubl conjugation pathway, Zinc, Zinc-finger
Deposited on 2009-09-24, released 2009-11-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: E3 ubiquitin-protein ligase Mdm2
  Species: Homo sapiens [TaxId:9606]
  Gene: MDM2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00987 (1-End)
    • expression tag (0)
  Domains in SCOPe 2.06: d3jzra1, d3jzra2
• Chain 'P':
  Compound: pDI6W peptide (12mer)
  Database cross-references and differences (RAF-indexed):
  • PDB 3JZR (0-11)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3jzrA (A:)
  gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
  ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3jzrA (A:)
  gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
  ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnq
  

  
  
• Chain 'P':
  No sequence available.