PDB entry 3jzr

View 3jzr on RCSB PDB site
Description: Human MDM2 liganded with a 12mer peptide inhibitor (pDI6W)
Class: ligase
Keywords: P53-BINDING PROTEIN MDM2, ONCOPROTEIN MDM2, DOUBLE MINUTE 2 PROTEIN, HDM2, Alternative splicing, Cytoplasm, Host-virus interaction, Ligase, Metal-binding, Nucleus, Phosphoprotein, Proto-oncogene, Ubl conjugation, Ubl conjugation pathway, Zinc, Zinc-finger
Deposited on 2009-09-24, released 2009-11-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.05: d3jzra_
  • Chain 'P':
    Compound: pDI6W peptide (12mer)
    Database cross-references and differences (RAF-indexed):
    • PDB 3JZR (0-11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jzrA (A:)
    gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
    ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jzrA (A:)
    gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
    ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnq
    

  • Chain 'P':
    No sequence available.