PDB entry 3jzr
View 3jzr on RCSB PDB site
Description: Human MDM2 liganded with a 12mer peptide inhibitor (pDI6W)
Class: ligase
Keywords: P53-BINDING PROTEIN MDM2, ONCOPROTEIN MDM2, DOUBLE MINUTE 2 PROTEIN, HDM2, Alternative splicing, Cytoplasm, Host-virus interaction, Ligase, Metal-binding, Nucleus, Phosphoprotein, Proto-oncogene, Ubl conjugation, Ubl conjugation pathway, Zinc, Zinc-finger
Deposited on
2009-09-24, released
2009-11-10
The last revision prior to the SCOPe 2.05 freeze date was dated
2010-01-26, with a file datestamp of
2010-01-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: E3 ubiquitin-protein ligase Mdm2
Species: Homo sapiens [TaxId:9606]
Gene: MDM2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d3jzra_ - Chain 'P':
Compound: pDI6W peptide (12mer)
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3jzrA (A:)
gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
Sequence, based on observed residues (ATOM records): (download)
>3jzrA (A:)
gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnq
- Chain 'P':
No sequence available.