PDB entry 3jzq

View 3jzq on RCSB PDB site
Description: Human MDMX liganded with a 12mer peptide inhibitor (pDIQ)
Class: cell cycle
Keywords: CELL CYCLE, P53-BINDING PROTEIN MDM4, DOUBLE MINUTE 4 PROTEIN, Alternative splicing, Metal-binding, Nucleus, Polymorphism, Zinc, Zinc-finger
Deposited on 2009-09-24, released 2009-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Mdm4
    Species: Homo sapiens [TaxId:9606]
    Gene: mdm4, mdmx
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jzqa_
  • Chain 'B':
    Compound: Protein Mdm4
    Species: Homo sapiens [TaxId:9606]
    Gene: mdm4, mdmx
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jzqb_
  • Chain 'P':
    Compound: pDIQ peptide (12mer)
    Database cross-references and differences (RAF-indexed):
    • PDB 3JZQ (0-11)
  • Chain 'Q':
    Compound: pDIQ peptide (12mer)
    Database cross-references and differences (RAF-indexed):
    • PDB 3JZQ (0-11)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jzqA (A:)
    qinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllg
    ellgrqsfsvkdpsplydmlrknlvtlat
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jzqA (A:)
    nqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgel
    lgrqsfsvkdpsplydmlrknlvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3jzqB (B:)
    qinqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllg
    ellgrqsfsvkdpsplydmlrknlvtlat
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jzqB (B:)
    nqvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgel
    lgrqsfsvkdpsplydmlrknlvtlat
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.