PDB entry 3jzk
View 3jzk on RCSB PDB site
Description: crystal structure of MDM2 with chromenotriazolopyrimidine 1
Class: ligase
Keywords: MDM2, p53, inhibitor, Alternative splicing, Cytoplasm, Host-virus interaction, Ligase, Metal-binding, Nucleus, Phosphoprotein, Proto-oncogene, Ubl conjugation, Ubl conjugation pathway, Zinc, Zinc-finger
Deposited on
2009-09-23, released
2009-11-17
The last revision prior to the SCOPe 2.01 freeze date was dated
2010-04-28, with a file datestamp of
2010-04-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.3
AEROSPACI score: 0.28
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: E3 ubiquitin-protein ligase Mdm2
Species: Homo sapiens [TaxId:9606]
Gene: MDM2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d3jzka_ - Heterogens: YIN, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3jzkA (A:)
gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
Sequence, based on observed residues (ATOM records): (download)
>3jzkA (A:)
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvv