PDB entry 3jze

View 3jze on RCSB PDB site
Description: 1.8 Angstrom resolution crystal structure of dihydroorotase (pyrC) from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
Class: hydrolase
Keywords: Dihydroorotase, pyrC, idp00873, Hydrolase, Metal-binding, Pyrimidine biosynthesis, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2009-09-23, released 2009-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 [TaxId:99287]
    Gene: pyrC, STM1163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jzea_
  • Chain 'B':
    Compound: dihydroorotase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 [TaxId:99287]
    Gene: pyrC, STM1163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jzeb_
  • Chain 'C':
    Compound: dihydroorotase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 [TaxId:99287]
    Gene: pyrC, STM1163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jzec_
  • Chain 'D':
    Compound: dihydroorotase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 [TaxId:99287]
    Gene: pyrC, STM1163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jzed_
  • Heterogens: ZN, CL, BME, PGE, ACY, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jzeA (A:)
    mhhhhhhssgvdlgtenlyfqsnamtapsqvlkirrpddwhvhlrdgdmlktvvpytsei
    ygraivmpnlaspittvdaaiayrqrildavpaghdftplmtcyltdsldadelergfhe
    gvftaaklypanattnsshgvtsvdaimpvlermeklgipllvhgevthadvdifdrear
    fidtvmeplrqrltalkvvfehittkdaaqyvrdgndylaatitpqhlmfnrndmlvggi
    rphlyclpilkrnihqqalrelvasgftraflgtdsaphsrhrketscgcagcfnapsal
    gsyaavfeemnalahfeafcslngpqfyglpmntgwvelvrdeqqipgnialaddslvpf
    lagetvrwsvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jzeA (A:)
    sqvlkirrpddwhvhlrdgdmlktvvpytseiygraivmpnlaspittvdaaiayrqril
    davpaghdftplmtcyltdsldadelergfhegvftaaklypanattnsshgvtsvdaim
    pvlermeklgipllvhgevthadvdifdrearfidtvmeplrqrltalkvvfehittkda
    aqyvrdgndylaatitpqhlmfnrndmlvggirphlyclpilkrnihqqalrelvasgft
    raflgtdsaphsrhrketscgcagcfnapsalgsyaavfeemnalahfeafcslngpqfy
    glpmntgwvelvrdeqqipgnialaddslvpflagetvrwsvkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3jzeB (B:)
    mhhhhhhssgvdlgtenlyfqsnamtapsqvlkirrpddwhvhlrdgdmlktvvpytsei
    ygraivmpnlaspittvdaaiayrqrildavpaghdftplmtcyltdsldadelergfhe
    gvftaaklypanattnsshgvtsvdaimpvlermeklgipllvhgevthadvdifdrear
    fidtvmeplrqrltalkvvfehittkdaaqyvrdgndylaatitpqhlmfnrndmlvggi
    rphlyclpilkrnihqqalrelvasgftraflgtdsaphsrhrketscgcagcfnapsal
    gsyaavfeemnalahfeafcslngpqfyglpmntgwvelvrdeqqipgnialaddslvpf
    lagetvrwsvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jzeB (B:)
    qvlkirrpddwhvhlrdgdmlktvvpytseiygraivmpnlaspittvdaaiayrqrild
    avpaghdftplmtcyltdsldadelergfhegvftaaklypanattnsshgvtsvdaimp
    vlermeklgipllvhgevthadvdifdrearfidtvmeplrqrltalkvvfehittkdaa
    qyvrdgndylaatitpqhlmfnrndmlvggirphlyclpilkrnihqqalrelvasgftr
    aflgtdsaphsrhrketscgcagcfnapsalgsyaavfeemnalahfeafcslngpqfyg
    lpmntgwvelvrdeqqipgnialaddslvpflagetvrwsvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3jzeC (C:)
    mhhhhhhssgvdlgtenlyfqsnamtapsqvlkirrpddwhvhlrdgdmlktvvpytsei
    ygraivmpnlaspittvdaaiayrqrildavpaghdftplmtcyltdsldadelergfhe
    gvftaaklypanattnsshgvtsvdaimpvlermeklgipllvhgevthadvdifdrear
    fidtvmeplrqrltalkvvfehittkdaaqyvrdgndylaatitpqhlmfnrndmlvggi
    rphlyclpilkrnihqqalrelvasgftraflgtdsaphsrhrketscgcagcfnapsal
    gsyaavfeemnalahfeafcslngpqfyglpmntgwvelvrdeqqipgnialaddslvpf
    lagetvrwsvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jzeC (C:)
    sqvlkirrpddwhvhlrdgdmlktvvpytseiygraivmpnlaspittvdaaiayrqril
    davpaghdftplmtcyltdsldadelergfhegvftaaklypanattnsshgvtsvdaim
    pvlermeklgipllvhgevthadvdifdrearfidtvmeplrqrltalkvvfehittkda
    aqyvrdgndylaatitpqhlmfnrndmlvggirphlyclpilkrnihqqalrelvasgft
    raflgtdsaphsrhrketscgcagcfnapsalgsyaavfeemnalahfeafcslngpqfy
    glpmntgwvelvrdeqqipgnialaddslvpflagetvrwsvkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3jzeD (D:)
    mhhhhhhssgvdlgtenlyfqsnamtapsqvlkirrpddwhvhlrdgdmlktvvpytsei
    ygraivmpnlaspittvdaaiayrqrildavpaghdftplmtcyltdsldadelergfhe
    gvftaaklypanattnsshgvtsvdaimpvlermeklgipllvhgevthadvdifdrear
    fidtvmeplrqrltalkvvfehittkdaaqyvrdgndylaatitpqhlmfnrndmlvggi
    rphlyclpilkrnihqqalrelvasgftraflgtdsaphsrhrketscgcagcfnapsal
    gsyaavfeemnalahfeafcslngpqfyglpmntgwvelvrdeqqipgnialaddslvpf
    lagetvrwsvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jzeD (D:)
    qvlkirrpddwhvhlrdgdmlktvvpytseiygraivmpnlaspittvdaaiayrqrild
    avpaghdftplmtcyltdsldadelergfhegvftaaklypanattnsshgvtsvdaimp
    vlermeklgipllvhgevthadvdifdrearfidtvmeplrqrltalkvvfehittkdaa
    qyvrdgndylaatitpqhlmfnrndmlvggirphlyclpilkrnihqqalrelvasgftr
    aflgtdsaphsrhrketscgcagcfnapsalgsyaavfeemnalahfeafcslngpqfyg
    lpmntgwvelvrdeqqipgnialaddslvpflagetvrwsvk