PDB entry 3jza

View 3jza on RCSB PDB site
Description: Crystal structure of human Rab1b in complex with the GEF domain of DrrA/SidM from Legionella pneumophila
Class: transport protein
Keywords: RabGDI, RabGEF, GDI, GEF, GDF, GDI displacement factor, GTP-binding, Lipoprotein, Membrane, Nucleotide-binding, Prenylation, Protein transport, TRANSPORT PROTEIN
Deposited on 2009-09-23, released 2010-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-1B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3jzaa_
  • Chain 'B':
    Compound: Uncharacterized protein DrrA
    Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
    Gene: lpg2464
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jzaA (A:)
    ghmpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktikl
    qiwdtagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllv
    gnksdlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jzaA (A:)
    eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
    tagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvgnks
    dlttkkvvdnttakefadslgipfletsnatnveqafmtmaaeikkrm
    

  • Chain 'B':
    No sequence available.