PDB entry 3jy0

View 3jy0 on RCSB PDB site
Description: Discovery of 3H-benzo[4,5]thieno[3,2-d]pyrimidin-4-ones as Potent, Highly Selective and Orally Bioavailable Pim Kinases Inhibitors
Class: transferase
Keywords: PIM-1, Alternative initiation, ATP-binding, Cell membrane, Cytoplasm, Kinase, Manganese, Membrane, Metal-binding, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Proto-oncogene, Serine/threonine-protein kinase, Transferase
Deposited on 2009-09-21, released 2009-11-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-11-10, with a file datestamp of 2009-11-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3jy0a_
  • Heterogens: LYG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jy0A (A:)
    mkekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvp
    mevvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsf
    fwqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvy
    sppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhli
    rwclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpskvdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jy0A (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlhsl