PDB entry 3jxz

View 3jxz on RCSB PDB site
Description: Bacillus cereus Alkylpurine DNA Glycosylase AlkD Bound to DNA Containing an Abasic Site (across from T)
Class: hydrolase/DNA
Keywords: HEAT repeat, DNA binding, DNA glycosylase, DNA alkylation, lyase-DNA COMPLEX, hydrolase-DNA COMPLEX
Deposited on 2009-09-21, released 2010-09-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.187
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkylpurine DNA Glycosylase AlkD
    Species: Bacillus cereus [TaxId:222523]
    Gene: AlkD, BC_4913
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3jxza_
  • Chain 'B':
    Compound: DNA (5'-d(*tp*gp*gp*gp*(3dr)p*gp*gp*cp*tp*t)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*ap*gp*cp*cp*tp*cp*cp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3jxzA (A:)
mhpfvkalqehftahqnpekaepmarymknhflflgiqtperrqllkdiiqihtlpdqkd
fqiiirelwdlperefqaaaldimqkykkhinethipfleelivtkswwdsvdsivptfl
gdiflkhpelisayipkwiasdniwlqraailfqlkykqkmdeellfwiigqlhsskeff
iqkaigwvlreyaktnpdvvweyvqnnelaplskreaikhikqny

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.