PDB entry 3jxu

View 3jxu on RCSB PDB site
Description: Crystal structure of the human 70kDa heat shock protein 1A (Hsp70-1) ATPase domain in complex with ADP and inorganic phosphate
Class: chaperone
Keywords: helix, Structural Genomics, Structural Genomics Consortium, SGC, ATP-binding, Chaperone, Nucleotide-binding, Phosphoprotein, Polymorphism, Stress response
Deposited on 2009-09-21, released 2009-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock 70 kDa protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3jxua1, d3jxua2
  • Heterogens: ADP, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jxuA (A:)
    mhhhhhhssgvdlgtenlyfqsmakaaaigidlgttyscvgvfqhgkveiiandqgnrtt
    psyvaftdterligdaaknqvalnpqntvfdakrligrkfgdpvvqsdmkhwpfqvindg
    dkpkvqvsykgetkafypeeissmvltkmkeiaeaylgypvtnavitvpayfndsqrqat
    kdagviaglnvlriineptaaaiaygldrtgkgernvlifdlgggtfdvsiltiddgife
    vkatagdthlggedfdnrlvnhfveefkrkhkkdisqnkravrrlrtacerakrtlssst
    qasleidslfegidfytsitrarfeelcsdlfrstlepvekalrdakldkaqihdlvlvg
    gstripkvqkllqdffngrdlnksinpdeavaygaavqaailmgdksen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jxuA (A:)
    aaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvalnp
    qntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissmv
    ltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaiay
    gldrtgkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfve
    efkrkhkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfe
    elcsdlfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksi
    npdeavaygaavqaailm