PDB entry 3jxp

View 3jxp on RCSB PDB site
Description: Crystal Structure of the Coenzyme PQQ Synthesis Protein (PqqB) from Pseudomonas putida
Class: biosynthetic protein
Keywords: alpha-beta protein, pqq biosynthesis, Transport, BIOSYNTHETIC PROTEIN
Deposited on 2009-09-21, released 2010-09-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coenzyme PQQ synthesis protein B
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_0379, pqqB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88QV5 (2-304)
      • expression tag (1)
      • engineered (254)
      • expression tag (305)
    Domains in SCOPe 2.05: d3jxpa_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jxpA (A:)
    mmmyiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnasp
    diraqlqafapmqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdl
    ttgfplfnmlshwngglqwnrielegsfvidacpnlkftpfplrsaappysphrfdphpg
    dnlglmvedtrtggklfyapglgqvdekllammhgadcllvdgtlweddemqrrgvgtrt
    gremghlaqngpggtlevldgfprqrkvlihinntnpildensperaevlrrgvevafdg
    msiellehhhhhhlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jxpA (A:)
    mmyiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnaspd
    iraqlqafapmqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdlt
    tgfplfnmlshwngglqwnrielegsfvidacpnlkftpfplrsaappysphrfdphpgd
    nlglmvedtrtggklfyapglgqvdekllammhgadcllvdgtlweddemqrrgvgtrtg
    rmghlaqngpggtlevldgfprqrkvlihinntnpildensperaevlrrgvevafdgms
    iell