PDB entry 3jxh

View 3jxh on RCSB PDB site
Description: CA-like domain of human PTPRG
Class: cell adhesion
Keywords: CA-like domain, Alternative splicing, Glycoprotein, Hydrolase, Membrane, Phosphoprotein, Polymorphism, Protein phosphatase, Transmembrane, CELL ADHESION
Deposited on 2009-09-19, released 2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.179
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Receptor-type tyrosine-protein phosphatase gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPG, PTPRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jxhc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3jxhC (C:)
    gdpywaysgaygpehwvtssvscggrhqspidildqyarvgeeyqelqldgfdnessnkt
    wmkntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsingrrfpvemq
    iffynpddfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldp
    fvlrdllpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqdh
    vksveylrnnfrpqqrlhdrvvsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jxhC (C:)
    pywaysgaygpehwvtssvscggrhqspidildqyarvgeeyqelqldgfdnessnktwm
    kntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsingrrfpvemqif
    fynpddfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldpfv
    lrdllpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysifttesveylr
    nnfrpqqrlhdrvvsks