PDB entry 3jxf

View 3jxf on RCSB PDB site
Description: CA-like domain of human PTPRZ
Class: cell adhesion
Keywords: CA-like domain, Alternative splicing, Glycoprotein, Hydrolase, Membrane, Polymorphism, Protein phosphatase, Transmembrane, CELL ADHESION
Deposited on 2009-09-19, released 2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase zeta
    Species: Homo sapiens [TaxId:9606]
    Gene: HTPZP2, PTPRZ, PTPRZ1, PTPRZ2, PTPZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jxfa_
  • Chain 'B':
    Compound: Receptor-type tyrosine-protein phosphatase zeta
    Species: Homo sapiens [TaxId:9606]
    Gene: HTPZP2, PTPRZ, PTPRZ1, PTPRZ2, PTPZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23471 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d3jxfb1, d3jxfb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jxfA (A:)
    pgseeigwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdktsl
    entfihntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkfp
    lemqiycfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkqa
    aldpfillnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltmq
    qsgyvmlmdylqnnfreqqykfsrqvfssytg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jxfA (A:)
    eeigwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdktslent
    fihntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkfplem
    qiycfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkqaald
    pfillnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltmqqsg
    yvmlmdylqnnfreqqykfsrqvfssyt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3jxfB (B:)
    pgseeigwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdktsl
    entfihntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkfp
    lemqiycfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkqa
    aldpfillnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltmq
    qsgyvmlmdylqnnfreqqykfsrqvfssytg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jxfB (B:)
    pgseeigwsytgalnqknwgkkyptcnspkqspinidedltqvnvnlkklkfqgwdktsl
    entfihntgktveinltndyrvsggvsemvfkaskitfhwgkcnmssdgsehslegqkfp
    lemqiycfdadrfssfeeavkgkgklralsilfevgteenldfkaiidgvesvsrfgkqa
    aldpfillnllpnstdkyyiyngsltsppctdtvdwivfkdtvsisesqlavfcevltmq
    qsgyvmlmdylqnnfreqqykfsrqvfssyt