PDB entry 3jxd

View 3jxd on RCSB PDB site
Description: Crystal structure of the P22 c2 repressor protein in complex with synthetic operator 9C in the presence of Rb+
Class: transcription regulator
Keywords: protein-DNA complex, DNA-binding, Repressor, Transcription, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2009-09-18, released 2010-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*cp*ap*tp*tp*tp*ap*ap*gp*ap*cp*gp*tp*cp*tp*tp*ap*ap*ap*tp*g)-3'
    Species: synthetic, synthetic
  • Chain 'B':
    Compound: 5'-d(*cp*ap*tp*tp*tp*ap*ap*gp*ap*cp*gp*tp*cp*tp*tp*ap*ap*ap*tp*g)-3'
    Species: synthetic, synthetic
  • Chain 'L':
    Compound: Repressor protein C2
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: c2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3jxdl_
  • Chain 'R':
    Compound: Repressor protein C2
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: c2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3jxdr_
  • Heterogens: RB, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >3jxdL (L:)
ntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcsp
dyllkgd

    Sequence, based on observed residues (ATOM records): (download) 
    >3jxdL (L:)
tqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcspd
yllkgd

  • Chain 'R':
    Sequence, based on SEQRES records: (download) 
    >3jxdR (R:)
ntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcsp
dyllkgd

    Sequence, based on observed residues (ATOM records): (download) 
    >3jxdR (R:)
tqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcspd
yllkgd