PDB entry 3jxc

View 3jxc on RCSB PDB site
Description: Crystal structure of the P22 c2 repressor protein in complex with synthetic operator 9T in the presence of Tl+
Class: transcription regulator
Keywords: protein-DNA complex, DNA-binding, Repressor, Transcription, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2009-09-18, released 2010-01-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*cp*ap*tp*tp*tp*ap*ap*gp*ap*tp*ap*tp*cp*tp*tp*ap*ap*ap*tp*g)-3'
    Species: synthetic, synthetic
  • Chain 'B':
    Compound: 5'-d(*cp*ap*tp*tp*tp*ap*ap*gp*ap*tp*ap*tp*cp*tp*tp*ap*ap*ap*tp*g)-3'
    Species: synthetic, synthetic
  • Chain 'L':
    Compound: Repressor protein C2
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: c2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3jxcl_
  • Chain 'R':
    Compound: Repressor protein C2
    Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
    Gene: c2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3jxcr_
  • Heterogens: TL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3jxcL (L:)
    ntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcsp
    dyllkgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jxcL (L:)
    tqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcspd
    yllkgd
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3jxcR (R:)
    ntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcsp
    dyllkgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jxcR (R:)
    tqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcspd
    yllkgd