PDB entry 3jxb

View 3jxb on RCSB PDB site
Description: Crystal structure of the P22 c2 repressor protein in complex with synthetic operator 9C
Class: transcription regulator
Keywords: protein-DNA complex, DNA-binding, Repressor, Transcription, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2009-09-18, released 2010-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.198
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 5'-d(*cp*ap*tp*tp*tp*ap*ap*gp*ap*cp*gp*tp*cp*tp*tp*ap*ap*ap*tp*a)-3'
  Species: synthetic, synthetic
  
• Chain 'B':
  Compound: 5'-d(*tp*ap*tp*tp*tp*ap*ap*gp*ap*cp*gp*tp*cp*tp*tp*ap*ap*ap*tp*g)-3'
  Species: synthetic, synthetic
  
• Chain 'C':
  Compound: Repressor protein C2
  Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
  Gene: c2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P69202 (0-66)
  Domains in SCOPe 2.08: d3jxbc_
• Chain 'D':
  Compound: Repressor protein C2
  Species: ENTEROBACTERIA PHAGE P22 [TaxId:10754]
  Gene: c2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P69202 (Start-66)
  Domains in SCOPe 2.08: d3jxbd_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3jxbC (C:)
  ntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcsp
  dyllkgd
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >3jxbD (D:)
  ntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcsp
  dyllkgd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3jxbD (D:)
  qlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcspdy
  llkgd