PDB entry 3jx7

View 3jx7 on RCSB PDB site
Description: Bacillus cereus alkylpurine DNA glycosylase AlkD bound to DNA containing a 3-METHYLADENINE analog
Class: hydrolase/DNA
Keywords: HEAT repeat, DNA binding, DNA glycosylase, DNA alkylation, lyase-DNA COMPLEX, HYDROLASE-DNA COMPLEX
Deposited on 2009-09-18, released 2010-09-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.16
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Alkylpurine DNA Glycosylase AlkD
  Species: Bacillus cereus [TaxId:222523]
  Gene: AlkD, BC_4913
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q816E8 (1-231)
    • expression tag (0)
  Domains in SCOPe 2.01: d3jx7a_
• Chain 'B':
  Compound: DNA (5'-d(*cp*gp*gp*ap*cp*tp*(dzm)p*ap*cp*gp*gp*g)-3')
  
• Chain 'C':
  Compound: DNA (5'-d(*cp*cp*cp*gp*tp*tp*ap*gp*tp*cp*cp*g)-3')
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3jx7A (A:)
  pmhpfvkalqehftahqnpekaepmarymknhflflgiqtperrqllkdiiqihtlpdqk
  dfqiiirelwdlperefqaaaldimqkykkhinethipfleelivtkswwdsvdsivptf
  lgdiflkhpelisayipkwiasdniwlqraailfqlkykqkmdeellfwiigqlhsskef
  fiqkaigwvlreyaktnpdvvweyvqnnelaplskreaikhikqnyginnek
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.